Products Categories
  • Ms.Pang
    Tel: +86-021-50792271

  • Mobile:13816597601
  • Tel:+86-021-50792271
  • Fax:+86-
  • URL:http://www.chinapeptides.com
  • Province/state:
  • City:shanghai
  • Street:Building 24A, 300 Chuantu Road, Chuansha, Pudong new area, Shanghai, China, 201202
  • MaxCard:
Home > Products >  Galanin, rat

Galanin, rat CAS NO.114547-31-8

  • Min.Order: 0
  • Payment Terms:
  • Product Details

Keywords

  • GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
  • H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 (trifluoroacetate salt)

Quick Details

  • ProName: Galanin, rat
  • CasNo: 114547-31-8
  • Molecular Formula: C141H211N43O41
  • Appearance: 3164.5
  • Application: Applied to various scientific research
  • PackAge: Bottle
  • Purity: 80%,90%,95%,98%,99%
  • Storage: Store at -25°C. Keep tightly closed. S...
  • LimitNum: 0

Superiority

*High density and high throughput: simultaneous determination of tens of thousands of protein peptide biochemical reactions

*High specificity: deeply reveal the protein binding mechanism, accurately locate the specific epitope of antibody and protein binding area

*Low cost, short cycle and simple operation: the cost of peptide array chip based on chemical synthesis is one hundred percent of that of anti chip and whole protein chip based on biological culture

*Accurate and reliable: stable purity, clear results, intuitive and easy to analyze

Details

Founded in October 2008, Chinapeptides Co., Ltd. is a high-tech enterprise focusing on peptide synthesis, antibody preparation and protein expression.

Chinapeptides biological was founded in Zhangjiang pharmaceutical valley of Shanghai, and has accumulated a large number of advantageous technologies and talents in Zhangjiang pharmaceutical valley. In 2014, CRM customer management system and ERP system were introduced respectively, which realized efficient customer management relationship and integrated system management of market, sales, procurement, production, quality control and finance, which provided strong "day after day" support for Chinapeptides biological to maintain high-speed development.

After years of development, Chinapeptides has finally won the recognition of thousands of customers with the service concept of high quality and keeping pace with the times. It has successfully positioned the brand of Chinapeptides as the middle and high-end brand in the industry. Its authenticity, honesty, hard work and heart are always around the customers. Our clients include biomedical research institutions in universities, hospitals, research institutes and some biological companies, as well as research institutions in more than 50 countries and regions in Asia, Europe, America and Oceania.

Introduction of peptides products
Common linear peptide: chain length up to 189 amino acids, milligram to kilogram level, purity up to 99%;

Simple modified peptides: free N-terminal acetylation, C-terminal amidation;

Complex modified peptides: fluorescently labeled peptides (Cy3, Cy5, Cy5.5, Cy7, FAM, FITC, Rhodamine B, TAMRA, etc.).Isotope labeling (N15, C13),StapledPeptide), fatty acid modified peptides (Pal, Myr, Ste), phosphorylated modified peptides (p-Ser, p-Thr, p-Tyr), cyclic peptides (amide ring, one or more disulfide rings and site-directed cyclization), biotin-labeled peptides (BIOTIN), complex antigen peptides (MAP4, MAP8, MAP16), chelators (HYNIC), small molecule compounds, PEG modification, fluorescence quenching group labeling (EDANS, DABCYL)Methylation modification (Lys, Arg), photosensitizer modification, DOTA, NOTA, DOPA, azide modification, two branched peptides with different sequences, multiple pairs of disulfide bonds between two peptidess with different sequences, etc.

Protein coupling: KLH, NSA, OVA;

Peptides containing special amino acids: containing D-type amino acids and other amino acid derivatives;

Different purity ranges: crude peptide, desalination, >70, >80%, >90, >95%, >98%, >99%;

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog